Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSAAENGEAAPGKQNEEKTYKKTQVKNQILSRLPKIPCTFIQAWTNTEM ITLLACYYFRSVSTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSIC SEPLIELSNPGASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLN QNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYK RRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLE SFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQKVLYSTAMES IQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFTGIIDILQSYRLMKK LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKR CNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRP DLVPSTPSLFEAASLATTISSSSLYVNEHYPHDRPTLYSNRFKMATSEH
    • Amino acids
      1 to 549
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MSS 4
    • MSS4
    • Phosphatidylinositol 4 phosphate 5 kinase type 1 beta
    • Phosphatidylinositol-4-phosphate 5-kinase type I beta
    • Phosphatidylinositol-4-phosphate 5-kinase type-1 beta
    • PI4P5K 1 beta
    • PI51B_HUMAN
    • PIP5K1-beta
    • PIP5K1B
    • PIP5KIbeta
    • Pipk 5 beta
    • Pipk 5b
    • Protein STM 7
    • Protein STM-7
    • PtdIns(4)P-5-kinase 1 beta
    • STM 7
    • STM7
    • STM7 LSB
    • Type I phosphatidylinositol 4 phosphate 5 kinase beta
    • Type I phosphatidylinositol-4-phosphate 5-kinase beta
    see all
  • Function
    Mediates RAC1-dependent reorganization of actin filaments (By similarity). Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate.
  • Tissue specificity
    Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.
  • Sequence similarities
    Contains 1 PIPK domain.
  • Cellular localization
    Endomembrane system. Associated with membranes.
  • Information by UniProt

Images

  • ab160018 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up