Overview

  • Product name
    Recombinant Human PIP5KL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTIN LGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSLIFR TARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLATVY GLRKRLEHLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE
    • Amino acids
      1 to 191
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA203J24.5
    • EC 2.7.1.68
    • MGC46424
    • phosphatidylinositol 4 phosphate 5 kinase like 1
    • phosphatidylinositol phosphate kinase homolog
    • Phosphatidylinositol-4-phosphate 5-kinase-like protein 1
    • PI(4)P 5 kinase like protein 1
    • PI(4)P 5-kinase-like protein 1
    • PI5L1_HUMAN
    • PIP5KL1
    • PIPKH
    • PtdIns(4)P 5 kinase like protein 1
    • PtdIns(4)P-5-kinase-like protein 1
    • RP11-203J24.5
    see all
  • Function
    May act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
  • Sequence similarities
    Contains 1 PIPK domain.
  • Cellular localization
    Cytoplasm. Membrane. Localized to large cytoplasmic vesicular structures.
  • Information by UniProt

Images

  • ab165420 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up