Description

  • Product name

    Recombinant Human PITPN protein
  • Purity

    > 95 % SDS-PAGE.
    ab101666 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEAS KNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGA LNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEP EAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQE LVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFC WLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 270
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 10% Glycerol

General Info

  • Alternative names

    • MGC99649
    • Phosphatidylinositol transfer protein alpha
    • Phosphatidylinositol transfer protein alpha isoform
    • Phosphotidylinositol transfer protein
    • PI-TP-alpha
    • PIPNA_HUMAN
    • PITP alpha
    • Pitpna
    • PITPNB
    • PtdIns transfer protein alpha
    • PtdInsTP
    • PtdInsTP alpha
    • Vb
    • VIB1A
    • Vibrator
    see all
  • Function

    Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.
  • Tissue specificity

    Expressed in a wide range of tissues.
  • Sequence similarities

    Belongs to the PtdIns transfer protein family. PI transfer class I subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101666.

References

ab101666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up