Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASL RLKAKQHSSFGYASVQNPASNLSACQYAVDRP
    • Molecular weight

      35 kDa including tags
    • Amino acids

      235 to 316

Specifications

Our Abpromise guarantee covers the use of ab152614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as PITX2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • All1 responsive gene 1
    • ALL1 responsive protein ARP1
    • ALL1-responsive protein ARP1
    • ARP 1
    • ARP1
    • Brx 1
    • Brx1
    • Homeobox protein PITX2
    • IDG 2
    • IDG2
    • IGDS
    • IGDS 2
    • IGDS2
    • IHG 2
    • IHG2
    • IRID 2
    • IRID2
    • MGC111022
    • MGC20144
    • Otlx 2
    • Otlx2
    • Paired like homeodomain transcription factor 2
    • Paired-like homeodomain transcription factor 2
    • Pituitary homeo box 2
    • Pituitary homeobox 2
    • PITX 2
    • pitx2
    • PITX2_HUMAN
    • PTX 2
    • PTX2
    • RGS
    • RIEG
    • RIEG 1
    • RIEG bicoid related homeobox transcription factor
    • Rieg bicoid related homeobox transcription factor 1
    • RIEG bicoid-related homeobox transcription factor
    • RIEG1
    • RS
    • Solurshin
    see all
  • Function

    May play an important role in development and maintenance of anterior structures. Isoform PTX2C is involved in left-right asymmetry the developing embryo.
  • Involvement in disease

    Defects in PITX2 are the cause of Axenfeld-Rieger syndrome type 1 (RIEG1) [MIM:180500]; also known as Rieger syndrome type 1. RIEG1 is an autosomal dominant defect characterized by hypodontia (partial anodontia), anal stenosis, hypertelorism, mental deficiency, agenesis of the facial bones, with malformation of the anterior chamber of the eye.
    Defects in PITX2 are the cause of iridogoniodysgenesis type 2 (IRID2) [MIM:137600]; also known as iridogoniodysgenesis syndrome 2 (IGDS2). It is an autosomal dominant inherited disease.
    Defects in PITX2 are a cause of Peters anomaly (PAN) [MIM:604229]. It is a congenital defect of the anterior chamber of the eye.
    Defects in PITX2 are associated with ring dermoid of cornea (RDC) [MIM:180550]. RDC is an autosomal dominantly inherited syndrome characterized by bilateral annular limbal dermoids with corneal and conjunctival extension.
  • Sequence similarities

    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab152614 stained with Coomassie Blue.

References

ab152614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up