Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSQYTEKEPAAMDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMT RHERSLGRAGDDYEVLELDDVPKENSSGSSPLDQVDSSLPSEPIFEKSET EIPTCGSALNQTTESSQSFVAVHHSEEGRDTLGSSTNLHNHSEGEYIPGA CSASSVQNGIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNT VFELENREAEAYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVH QNSQEIQRSSQDEMVSTKQQNNTSQERQTEHSPEDAACGPGHICSERNTN DREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREAL EVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA TAGRQEVDNTFWNGCGDYYQLYDKDEDSSECSDGEWSASLPHRFSGTEKD QSSSDESWETLPGKDENEPELQSDSSGPEEENQELSLQEGEQTSLEEGEI PWLQYNEVNESSSDEGNEPANEFAQPAFMLDGNNNLEDDSSVSEDLDVDW SIFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVD VEVANPPASKESIDGLPETLVLEDHTAIGQEQCCPICCSEYIKDDIATEL PCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIEASAAPSSEPDPDAPPS NDSIAEAP
    • Molecular weight

      105 kDa including tags
    • Amino acids

      1 to 708

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin protein ligase Praja2
    • E3 ubiquitin-protein ligase Praja-2
    • KIAA0438
    • Neurodap 1
    • Neurodap1
    • PJA 2
    • PJA2
    • PJA2_HUMAN
    • Praja 2
    • Praja 2 RING H2 motif containing
    • praja ring finger 2
    • Praja ring finger 2 E3 ubiquitin protein ligase
    • Praja2
    • RING finger protein 131
    • RNF 131
    • RNF131
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132619 stained with Coomassie Blue.

References

ab132619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up