Description

  • Product name

    Recombinant Human PKA R2/PKR2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVL PAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSV CAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQ VLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQY DNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRK MFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGN QEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLG PCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 382

Specifications

Our Abpromise guarantee covers the use of ab132177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as PKA R2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cAMP dependent protein kinase regulatory subunit alpha 2
    • cAMP dependent protein kinase regulatory subunit RII alpha
    • cAMP dependent protein kinase type II alpha regulatory chain
    • cAMP dependent protein kinase type II alpha regulatory subunit
    • cAMP-dependent protein kinase type II-alpha regulatory subunit
    • KAP2
    • KAP2_HUMAN
    • MGC3606
    • PKR 2
    • PKR2
    • PRKA R2
    • PRKAR 2
    • PRKAR2
    • PRKAR2A
    • Protein kinase A RII alpha subunit
    • Protein kinase cAMP dependent regulatory type II alpha
    see all
  • Function

    Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
  • Tissue specificity

    Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
  • Sequence similarities

    Belongs to the cAMP-dependent kinase regulatory chain family.
    Contains 2 cyclic nucleotide-binding domains.
  • Post-translational
    modifications

    Phosphorylated by the activated catalytic chain.
  • Cellular localization

    Cytoplasm. Cell membrane. Colocalizes with PJA2 in the cytoplasm and the cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132177 stained with Coomassie Blue.

References

ab132177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up