Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQE LGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRS VERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVESFAGSPLSYRP VAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTV WVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRK GVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVF LAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGAD CIMLSGETAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRD PTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSA QAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGD LVIVVTGWRPGSGYTNIMRVLSIS
    • Molecular weight

      88 kDa including tags
    • Amino acids

      1 to 574

Specifications

Our Abpromise guarantee covers the use of ab132446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 2.7.1.40
    • KPYR_HUMAN
    • L-PK
    • Pk-1
    • PK1
    • PKL
    • Pklg
    • Pklr
    • PKR
    • PKRL
    • Pyruvate kinase 1
    • Pyruvate kinase isozymes R/L
    • Pyruvate kinase liver and blood cell
    • Pyruvate kinase liver and RBC
    • Pyruvate kinase liver and red blood cell
    • Pyruvate kinase liver type
    • Pyruvate kinase type L
    • Pyruvate kinase, red cell type
    • R type/L type pyruvate kinase
    • R-PK
    • R-type/L-type pyruvate kinase
    • Red cell/liver pyruvate kinase
    • RPK
    see all
  • Function

    Plays a key role in glycolysis.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.
  • Involvement in disease

    Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) [MIM:102900]; also known as high red cell ATP syndrome. This autosomal dominant phenotype is characterized by increase of red blood cell ATP.
    Defects in PKLR are the cause of pyruvate kinase deficiency of red cells (PKRD) [MIM:266200]. A frequent cause of hereditary non-spherocytic hemolytic anemia. Clinically, pyruvate kinase-deficient patients suffer from a highly variable degree of chronic hemolysis, ranging from severe neonatal jaundice and fatal anemia at birth, severe transfusion-dependent chronic hemolysis, moderate hemolysis with exacerbation during infection, to a fully compensated hemolysis without apparent anemia.
  • Sequence similarities

    Belongs to the pyruvate kinase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132446 stained with Coomassie Blue.

References

ab132446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up