Description

  • Product name

    Recombinant human PKLR protein
    See all PKLR proteins and peptides
  • Biological activity

    Specific activity: > 0.1 unit/mg. One unit will form 1.0 µmol of phosphoenolpyruvate to pyruvate per minute at pH 7.5 at 37°C.
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMLTQELGTAFFQQQQLPAAMADTFLEHLCL LDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHE YHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEV ELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLIS LVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFG VEHGVDIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDE ILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLE SMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKMQHAIA REAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLT TTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIW ADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      47 to 574
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 1.17% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EC 2.7.1.40
    • KPYR_HUMAN
    • L-PK
    • Pk-1
    • PK1
    • PKL
    • Pklg
    • Pklr
    • PKR
    • PKRL
    • Pyruvate kinase 1
    • Pyruvate kinase isozymes R/L
    • Pyruvate kinase liver and blood cell
    • Pyruvate kinase liver and RBC
    • Pyruvate kinase liver and red blood cell
    • Pyruvate kinase liver type
    • Pyruvate kinase type L
    • Pyruvate kinase, red cell type
    • R type/L type pyruvate kinase
    • R-PK
    • R-type/L-type pyruvate kinase
    • Red cell/liver pyruvate kinase
    • RPK
    see all
  • Function

    Plays a key role in glycolysis.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.
  • Involvement in disease

    Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) [MIM:102900]; also known as high red cell ATP syndrome. This autosomal dominant phenotype is characterized by increase of red blood cell ATP.
    Defects in PKLR are the cause of pyruvate kinase deficiency of red cells (PKRD) [MIM:266200]. A frequent cause of hereditary non-spherocytic hemolytic anemia. Clinically, pyruvate kinase-deficient patients suffer from a highly variable degree of chronic hemolysis, ranging from severe neonatal jaundice and fatal anemia at birth, severe transfusion-dependent chronic hemolysis, moderate hemolysis with exacerbation during infection, to a fully compensated hemolysis without apparent anemia.
  • Sequence similarities

    Belongs to the pyruvate kinase family.
  • Information by UniProt

Images

  • 15% SDS-Page analysis of ab167971 (3µg).

References

ab167971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up