For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-pkm2-protein-bsa-and-azide-free-ab178466.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Recombinant Human PKM2 protein (BSA and azide free) (ab178466)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human PKM2 protein (BSA and azide free) (ab178466)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 90% Densitometry
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: His tag N-Terminus
    • Suitable for: ELISA, MS, SDS-PAGE, WB

    Description

    • Product name

      Recombinant Human PKM2 protein (BSA and azide free)
      See all PKM2 proteins and peptides
    • Purity

      > 90 % Densitometry.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      P14618
    • Protein length

      Full length protein
    • Animal free

      No
    • Carrier free

      Yes
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MKHHHHHHASKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITA RNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVR TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKI TLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADF LVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFA SFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMV ARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTR AEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHL QLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVA RYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNF AMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
      • Predicted molecular weight

        59 kDa including tags
      • Amino acids

        2 to 531
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-Pyruvate kinase isozyme M1 antibody (ab116271)
      • Anti-PKM antibody (ab137791)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab178466 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      Mass Spectrometry

      SDS-PAGE

      Western blot

    • Mass spectrometry

      LC-MS/MS
    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

      Constituents: 0.29% Sodium chloride, 0.24% Tris

    • Reconstitution
      Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. ab178466 is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

    General Info

    • Alternative names

      • CTHBP
      • Cytosolic thyroid hormone binding protein
      • Cytosolic thyroid hormone-binding protein
      • KPYM_HUMAN
      • MGC3932
      • OIP 3
      • OIP-3
      • OIP3
      • OPA interacting protein 3
      • Opa-interacting protein 3
      • p58
      • PK muscle type
      • PK, muscle type
      • PK2
      • PK3
      • PKM
      • PKM2
      • pykm
      • Pyruvate kinase 2/3
      • Pyruvate kinase 3
      • Pyruvate kinase isozymes M1/M2
      • Pyruvate kinase muscle
      • Pyruvate kinase muscle isozyme
      • pyruvate kinase PKM
      • Pyruvate kinase, muscle 2
      • TCB
      • THBP1
      • Thyroid hormone binding protein 1
      • Thyroid hormone binding protein cytosolic
      • Thyroid hormone-binding protein 1
      • Tumor M2 PK
      • Tumor M2-PK
      see all
    • Function

      Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. Stimulates POU5F1-mediated transcriptional activation. Plays a general role in caspase independent cell death of tumor cells. The ratio between the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production. The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival.
    • Tissue specificity

      Specifically expressed in proliferating cells, such as embryonic stem cells, embryonic carcinoma cells, as well as cancer cells.
    • Pathway

      Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.
    • Sequence similarities

      Belongs to the pyruvate kinase family.
    • Post-translational
      modifications

      Phosphorylated upon DNA damage, probably by ATM or ATR.
      ISGylated.
    • Cellular localization

      Cytoplasm. Nucleus. Translocates to the nucleus in response to different apoptotic stimuli. Nuclear translocation is sufficient to induce cell death that is caspase independent, isoform-specific and independent of its enzymatic actvity.
    • Target information above from: UniProt accession P14618 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human PKM2 protein (BSA and azide free) (ab178466)
      SDS-PAGE - Recombinant Human PKM2 protein (BSA and azide free) (ab178466)

      SDS-PAGE analysis of ab178466

      1) Reduced and heated sample, 2.5 μg/lane

      2) Non-reduced and non-heated sample, 2.5 μg/lane.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab178466? Please let us know so that we can cite the reference in this datasheet.

    ab178466 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab178466.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.