Description

  • Product name

    Recombinant human PKN1 protein
  • Biological activity

    The specific activity of ab207102 was determined to be 30 nmol/min/mg.

  • Purity

    > 90 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      REELAAASSAAFSTRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPE TIPWNPTPSMGGPGTPDSRPPFLSRPARGLYSRSGSLSGRSSLKAEAENT SEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFTLELERARELE LAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV IERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTG TFSPGASPGSEARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSP IQESTAPELPSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFGKVL LSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVN LFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQF LHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPE FLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVND EVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWE ALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQA AFLDFDFVAGGC
    • Predicted molecular weight

      115 kDa including tags
    • Amino acids

      289 to 942
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      BC040061

Specifications

Our Abpromise guarantee covers the use of ab207102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DBK
    • PAK 1
    • PAK-1
    • PAK1
    • PKC1
    • PKN
    • PKN ALPHA
    • Pkn1
    • PKN1_HUMAN
    • PRK1
    • PRKCL1
    • Protease activated kinase 1
    • Protease-activated kinase 1
    • Protein kinase C like 1
    • Protein kinase C like PKN
    • Protein kinase C related kinase 1
    • Protein kinase C-like 1
    • Protein kinase C-like PKN
    • Protein kinase N1
    • Protein kinase PKN alpha
    • Protein kinase PKN-alpha
    • Protein-kinase C-related kinase 1
    • Serine threonine kinase N
    • Serine threonine protein kinase N
    • Serine-threonine protein kinase N
    • Serine/threonine protein kinase N1
    • Serine/threonine-protein kinase N1
    see all
  • Function

    PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Regulates the cytoskeletal network by phosphorylating proteins such as VIM and neurofilament proteins NEFH, NEFL and NEFM, leading to inhibit their polymerization. Phosphorylates 'Ser-575', 'Ser-637' and 'Ser-669' of MAPT/Tau, lowering its ability to bind to microtubules, resulting in disruption of tubulin assembly. Acts as a key coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and specifically mediating phosphorylation of 'Thr-11' of histone H3 (H3T11ph), a specific tag for epigenetic transcriptional activation that promotes demethylation of histone H3 'Lys-9' (H3K9me) by KDM4C/JMJD2C. Phosphorylates HDAC5, HDAC7 and HDAC9, leading to impair their import in the nucleus. Phosphorylates 'Thr-38' of PPP1R14A, 'Ser-159', 'Ser-163' and 'Ser-170' of MARCKS, and GFAP. Able to phosphorylate RPS6 in vitro.
  • Tissue specificity

    Found ubiquitously. Expressed in heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. Expressed in numerous tumor cell lines, especially in breast tumor cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 1 protein kinase domain.
    Contains 3 REM (Hr1) repeats.
  • Domain

    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications

    Autophosphorylated; preferably on serine. Phosphorylated during mitosis.
    Activated by limited proteolysis with trypsin.
  • Cellular localization

    Cytoplasm. Nucleus. Endosome. Cell membrane. Cleavage furrow. Midbody. Associates with chromatin in a ligand-dependent manner. Localization to endosomes is mediated via its interaction with RHOB. Association to the cell membrane is dependent on Ser-374 phosphorylation. Accumulates during telophase at the cleavage furrow and finally concentrates around the midbody in cytokinesis.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207102 by densitometry, approximate MW 115 kDa.

  • The specific activity of ab207102 was determined to be 30 nmol/min/mg.

References

ab207102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up