Overview

  • Product name

    Recombinant Human PLA2G12B protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCR YGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCY DTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTV WTLGCRPFMNSQRAACICAEEEKEEL
    • Molecular weight

      21 kDa including tags
    • Amino acids

      20 to 195
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 60 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.02% Potassium chloride, 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride

General Info

  • Alternative names

    • 2010002E04Rik
    • FKSG71
    • Group XIIB phospholipase A2
    • Group XIII secreted phospholipase A2
    • GXIIB
    • GXIIIsPLA2
    • MGC138151
    • Phospholipase A2, group XIIB
    • PLA2G12B
    • PLA2G13
    see all
  • Relevance

    Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]).
  • Cellular localization

    Secreted

Images

  • 10% SDS-PAGE analysis of ab135016 (2.8 µg) stained with Coomassie Blue.

References

ab135016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up