Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLM FDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNIL RLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQ VRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIG HSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKL KGDIDSNAAI DLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIML QNSSGIEKYN VDHHHHHH
    • Molecular weight

      51 kDa including tags
    • Amino acids

      22 to 441
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: Acetic acid buffer, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Platelet-activating factor acetylhydrolase precursor
    • 1 alkyl 2 acetylglycerophosphocholine esterase
    • 1-alkyl-2-acetylglycerophosphocholine esterase
    • 2 acetyl 1 alkylglycerophosphocholine esterase
    • 2-acetyl-1-alkylglycerophosphocholine esterase
    • EC 3.1.1.47 PAF acetylhydrolase PAF 2-acylhydrolase LDL associated phospholipase A2
    • Group VIIA phospholipase A2
    • Group-VIIA phospholipase A2
    • gVIIA PLA2
    • gVIIA-PLA2
    • LDL associated phospholipase A2
    • LDL PLA(2)
    • LDL PLA2
    • LDL-associated phospholipase A2
    • LDL-PLA(2)
    • Lipoprotein associated phospholipase A2
    • LP PLA2
    • PAF 2 acylhydrolase
    • PAF 2 acylhydrolase LDL associated phospholipase A2
    • PAF 2-acylhydrolase
    • PAF acetylhydrolase
    • PAFA_HUMAN
    • PAFAD
    • PAFAH
    • Phospholipase A2, group VII (platelet activating factor acetylhydrolase, plasma)
    • PLA2G7
    • Platelet activating factor acetylhydrolase
    • Platelet activating factor acetylhydrolase 2
    • Platelet-activating factor acetylhydrolase
    see all
  • Function

    Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Platelet-activating factor acetylhydrolase deficiency
    Asthma
    Atopic hypersensitivity
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Secreted, extracellular space.
  • Information by UniProt

References

ab152087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up