Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLM FDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNIL RLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQ VRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIG HSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKL KGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTN INTTNQHIMLQNSSGIEKYN
    • Molecular weight

      48 kDa
    • Amino acids

      22 to 441
    • Additional sequence information

      Mature form of PLA2G7 without signal peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to cleave a PAF analog in a chromogenic substrate linked assay. At a PLA2G7 concentration of 10.0 μg/ml, 50% cleavage was achieved at an incubation time of approximately 2 minutes.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituent: 0.121% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/m. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer (e.g. PBS) containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names

    • Platelet-activating factor acetylhydrolase precursor
    • 1 alkyl 2 acetylglycerophosphocholine esterase
    • 1-alkyl-2-acetylglycerophosphocholine esterase
    • 2 acetyl 1 alkylglycerophosphocholine esterase
    • 2-acetyl-1-alkylglycerophosphocholine esterase
    • EC 3.1.1.47 PAF acetylhydrolase PAF 2-acylhydrolase LDL associated phospholipase A2
    • Group VIIA phospholipase A2
    • Group-VIIA phospholipase A2
    • gVIIA PLA2
    • gVIIA-PLA2
    • LDL associated phospholipase A2
    • LDL PLA(2)
    • LDL PLA2
    • LDL-associated phospholipase A2
    • LDL-PLA(2)
    • Lipoprotein associated phospholipase A2
    • LP PLA2
    • PAF 2 acylhydrolase
    • PAF 2 acylhydrolase LDL associated phospholipase A2
    • PAF 2-acylhydrolase
    • PAF acetylhydrolase
    • PAFA_HUMAN
    • PAFAD
    • PAFAH
    • Phospholipase A2, group VII (platelet activating factor acetylhydrolase, plasma)
    • PLA2G7
    • Platelet activating factor acetylhydrolase
    • Platelet activating factor acetylhydrolase 2
    • Platelet-activating factor acetylhydrolase
    see all
  • Function

    Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Platelet-activating factor acetylhydrolase deficiency
    Asthma
    Atopic hypersensitivity
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Secreted, extracellular space.
  • Information by UniProt

References

ab204758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up