Description

  • Product name

    Recombinant Human Placental alkaline phosphatase (PLAP) protein
    See all Placental alkaline phosphatase (PLAP) proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQP AQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVA LSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNE VISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA RQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRL DGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLA PGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLD EETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAP PAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
    • Predicted molecular weight

      85 kDa including tags
    • Amino acids

      1 to 535
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • Alkaline phosphatase
    • Alkaline phosphatase placental
    • Alkaline phosphatase placental type
    • Alkaline phosphatase Regan isozyme
    • ALP
    • Alp1
    • ALPP
    • FLJ61142
    • Germ-cell alkaline phosphatase
    • nagao isozyme
    • OTTHUMP00000164354
    • PALP
    • Placental alkaline phosphatase 1
    • placental heat-stable alkaline phosphatase
    • placental type
    • PLAP
    • PLAP-1
    • PLAP1
    • PPB1_HUMAN
    see all
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of Human Placental alkaline phosphatase (PLAP) protein (ab114268). Stained with Coomassie Blue.

References

ab114268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up