Description

  • Product name

    Recombinant Human Placental alkaline phosphatase (PLAP) protein
    See all Placental alkaline phosphatase (PLAP) proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVT AARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYL CGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTR VQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVIL GGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNR TELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDT LSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYV LKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVH GVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDVDHHHHHH
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      23 to 506
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 23 to 506. The signal and propeptide peptides are not included.

Specifications

Our Abpromise guarantee covers the use of ab191941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Alkaline phosphatase
    • Alkaline phosphatase placental
    • Alkaline phosphatase placental type
    • Alkaline phosphatase Regan isozyme
    • ALP
    • Alp1
    • ALPP
    • FLJ61142
    • Germ-cell alkaline phosphatase
    • nagao isozyme
    • OTTHUMP00000164354
    • PALP
    • Placental alkaline phosphatase 1
    • placental heat-stable alkaline phosphatase
    • placental type
    • PLAP
    • PLAP-1
    • PLAP1
    • PPB1_HUMAN
    see all
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab191941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up