Recombinant Human Placental lactogen protein (ab158214)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLA IDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLE LLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTL MGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVE TFLRMVQCRSVEGSCGF
    • Amino acids
      1 to 217
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Choriomammotropin
    • chorionic somatomammotropin A
    • Chorionic somatomammotropin B
    • Chorionic somatomammotropin hormone
    • chorionic somatomammotropin hormone 1 (placental lactogen)
    • Chorionic somatomammotropin hormone 2
    • chorionic somatomammotropin-1
    • CS 2
    • CS-1
    • CS2
    • CSA
    • CSB
    • CSH_HUMAN
    • CSH1
    • CSH2
    • CSMT
    • hCS
    • hCS B
    • hCS-1
    • HCSB
    • Lactogen
    • mPL II
    • mplII
    • PL
    • Pl 2
    • Pl2
    • Placental lactogen
    • Placental lactogen II
    • Prl3b1
    • Prolactin 3B1
    • prolactin family 3, subfamily b, member 1
    • rPLII
    see all
  • Function
    Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
  • Sequence similarities
    Belongs to the somatotropin/prolactin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158214 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up