Overview

  • Product name

    Recombinant Human PLB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPITCPTQNEPFLRTPRNSNYTYPIKPAIENWGSDFLCTEWKASNSVPTS VHQLRPADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNL ETHTTLPNILKKFNPYLLGFSTSTWEGTAGLNVAAEGARARDMPAQAWDL LERMKNSPDINLEKDWKLVTLFIGVNDLCHYCENPEAHLATEYVQHIQQA LDILSEELPRAFVNVVEVMELASLYQGQGGKCAMLAAQNNCTCLRHSQSS LEKQELKKVNWNLQHGISSFSYWHQYTQREDFAVVVQPFFQNTLTPLNER GDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNFTHSRAK LKCPSPESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGIIGT VVWRCRRGGRREDPPMSLRTVAL
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 423

Specifications

Our Abpromise guarantee covers the use of ab132800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hPLB
    • Lysophospholipase
    • Phospholipase A2
    • Phospholipase B
    • Phospholipase B/lipase
    • Phospholipase B1
    • Phospholipase B1 membrane associated
    • PLB
    • PLB 1
    • PLB/LIP
    see all
  • Relevance

    PLB1 is a membrane-associated phospholipase which exhibits a calcium-independent broad substrate specificity including phospholipase A2/lysophospholipase activity. It shows preferential hydrolysis at the sn-2 position of diacylphospholipids and diacyglycerol, whereas it shows no positional specificity toward triacylglycerol. It also exhibits esterase activity toward p-nitrophenyl. It may act on the brush border membrane to facilitate the absorption of digested lipids.
  • Cellular localization

    Apical cell membrane; Single-pass type I membrane protein. Note: Present in the intestinal brush border membranes.

Images

  • 12.5% SDS-PAGE analysis of ab132800 stained with Coomassie Blue.

References

ab132800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up