Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHA RQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRS NLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQ DGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYK ALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELID RYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYH GHTLTSRILFKDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLT EILGEQLLSTTLDGVLPTQLPSPEELRRKILVKGKKLTLEEDLEYEEEEA EPELEESELALESQFETEPEPQEQNLQNKDKKKKSKPILCPALSSLVIYL KSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRV YPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSI VDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLR FVVMDYDWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGISLRPASIFVY ICIQEGLEGDES
    • Amino acids
      1 to 762
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase delta 4
    • 1-phosphatidylinositol 4
    • 5-bisphosphate phosphodiesterase delta-4
    • hPLCD4
    • MGC12837
    • Phosphoinositide phospholipase C delta 4
    • Phosphoinositide phospholipase C-delta-4
    • Phospholipase C delta 4
    • Phospholipase C-delta-4
    • PLC delta 4
    • PLC delta4
    • PLC-delta-4
    • PLCD4
    • PLCD4_HUMAN
    see all
  • Function
    Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.
  • Tissue specificity
    Highly expressed in skeletal muscle and kidney tissues, and at moderate level in intestinal tissue. Expressed in corneal epithelial cells.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 3 EF-hand domains.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Domain
    The PDZ-binding motif mediates the interaction with GRIP1.
    The C2 domain mediates pre-localization to the membrane prior to Ca(2+) import and non-selective Ca(2+)-mediated targeting to various cellular membranes.
    The PH domain is not a critical determinant of the membrane localization.
  • Cellular localization
    Membrane. Nucleus. Cytoplasm. Endoplasmic reticulum. Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up