Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGR ILLDGCTITCPCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEIT GAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNME QGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRS MGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVK QGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIK KLT
    • Amino acids

      1 to 353
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Pleckstrin 2
    • Pleckstrin 2 (mouse) homolog
    • Pleckstrin-2
    • PLEK 2
    • PLEK2
    • PLEK2_HUMAN
    see all
  • Function

    May help orchestrate cytoskeletal arrangement. Contribute to lamellipodia formation.
  • Sequence similarities

    Contains 1 DEP domain.
    Contains 2 PH domains.
  • Cellular localization

    Cell projection > lamellipodium membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up