Overview

  • Product name
    Recombinant Human PLEKHG5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCL AGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
    • Amino acids
      896 to 995
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apo 3
    • APO3
    • Apoptosis inducing receptor AIR
    • Apoptosis mediating receptor DR3
    • Apoptosis mediating receptor TRAMP
    • DDR3
    • Death domain receptor 3
    • DR3
    • DSMA 4
    • DSMA4
    • GEF 720
    • GEF720
    • Guanine nucleotide exchange factor 720
    • KIAA0720
    • LARD
    • Lymphocyte associated receptor of death
    • Novel PH domain containing protein
    • Pleckstrin homology domain containing family G member 5
    • Pleckstrin homology domain containing, family G (with RhoGef domain) member 5
    • PLEKHG 5
    • Putative NFkB activating protein
    • RP4 650H14.3
    • TNFRSF12
    • Tumor necrosis factor receptor superfamily member 25 precursor
    • WSL
    • WSL1
    see all
  • Relevance
    PLEKHG5 activates the nuclear factor kappa-B (NFKB1) signaling pathway. The gene maps to chromosome 1p36, within a 1.5-Mb interval linked to a form of autosomal recessive distal spinal muscular atrophy.
  • Cellular localization
    Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2:Cell membrane; Single-pass type I membrane protein. Isoform 9: Cell membrane; Single-pass type I membrane protein. Isoform 11: Cell membrane; Single-pass type I membrane protein. Isoform 3:Secreted. Isoform 4: Secreted. Isoform 5: Secreted. Isoform 6: Secreted. Isoform 7: Secreted.Isoform 8: Secreted. Isoform 10: Secreted. Isoform 12: Secreted

Images

  • ab163551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up