Description

  • Product name

    Recombinant Human Plexin A1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQL TNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKY GGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRS LLVLNSTSFLYYPDPVL
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      986 to 1152
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • NOV
    • NOV/plexin A1 protein
    • NOVP
    • Plexin-A1
    • Plexin1
    • PlexinA1
    • PLXA1_HUMAN
    • PLXN1
    • Plxna1
    • PLXNA1 protein
    • Semaphorin receptor NOV
    see all
  • Relevance

    Function: Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm. Tissue specificity: Detected in fetal brain, lung, liver and kidney. Similarity: Belongs to the plexin family. Contains 4 IPT/TIG domains. Contains 1 Sema domain.
  • Cellular localization

    Cell Membrane

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up