Recombinant human PLGF protein (Active) (ab174025)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVP RR
    • Molecular weight
      20 kDa including tags
    • Amino acids
      19 to 170
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using MDA - MB – 231 Human breast cancer cells.

    The ED50 for this effect is typically 1 - 10 µg/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute in 20 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C.

General Info

  • Alternative names
    • D12S1900
    • Pgf
    • PGFL
    • PIGF
    • Placenta growth factor
    • Placental growth factor
    • Placental growth factor, vascular endothelial growth factor related protein
    • PlGF
    • PlGF 2
    • PLGF_HUMAN
    • PlGF2
    • SHGC 10760
    see all
  • Function
    Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner.
  • Tissue specificity
    While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Domain
    Isoform PlGF-2 contains a basic insert which acts as a cell retention signal.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174025 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 28-33 kDa due to glycosylation.

References

ab174025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up