Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVP RR
    • Molecular weight
      20 kDa including tags
    • Amino acids
      19 to 170
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using MDA - MB – 231 Human breast cancer cells.

    The ED50 for this effect is typically 1 - 10 µg/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    The lyophilized product can be stored at 4°C or -80°C for 1 year. After reconstitution, store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -70°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    Constituents: 0.6% Acetic acid, 10% Trehalose

    pH 2-3

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute in 100 µl sterile deionized water to a stock solution of 200 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. To avoid surface adsorption loss and inactivation, the reconstituted protein must NOT be aliquoted to less than 5 µg per vial. Carrier protein (0.1% HSA or BSA) is recommended for further dilution (potential adsorption loss) and long term storage.

General Info

  • Alternative names
    • D12S1900
    • Pgf
    • PGFL
    • PIGF
    • Placenta growth factor
    • Placental growth factor
    • Placental growth factor, vascular endothelial growth factor related protein
    • PlGF
    • PlGF 2
    • PLGF_HUMAN
    • PlGF2
    • SHGC 10760
    see all
  • Function
    Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner.
  • Tissue specificity
    While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Domain
    Isoform PlGF-2 contains a basic insert which acts as a cell retention signal.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174025 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 28-33 kDa due to glycosylation.

References

ab174025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up