Overview

  • Product name

    Recombinant Human PLVAP/PV-1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NVHVSTESNLQATERRAEGLYSQLLGLTASQSNLTKELNFTTRAKDAIMQ MWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSEKQCRDQFKDM
    • Amino acids

      51 to 150
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PLVAP.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FELS
    • Fenestrated endothelial linked structure protein
    • Fenestrated endothelial-linked structure protein
    • gp68
    • Hypothetical protein DKFZp667O074
    • Meca 32 antigen
    • MECA32 antigen
    • Panendothelial cell antigen
    • Plasmalemma vesicle associated protein
    • Plasmalemma vesicle protein 1
    • Plasmalemma vesicle-associated protein
    • Plvap
    • PLVAP_HUMAN
    • PV 1
    • PV-1
    • PV1
    • PV1 protein
    see all
  • Function

    Involved in the formation of stomatal and fenestral diaphragms of caveolae. May function in microvascular permeability.
  • Tissue specificity

    Expressed in lung, kidney, heart, aorta, placenta, muscle, pituitary gland, adrenals, mammary gland, bladder, lymph node, bone marrow, trachea, digestive tract, liver and tumor-associated endothelium.
  • Cellular localization

    Cell membrane. Membrane > caveola. Cytoplasm > perinuclear region. Membrane-associated protein of caveolae. Found in fenestral and stomatal diaphragms in fenestrated endothelia and transendothelial channels. Also colocalized with CAV1 in perinuclear region.
  • Information by UniProt

Images

  • ab153539 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up