Overview

  • Product name

    Recombinant Human PLXNA3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      FRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPNLTELRAHVTGPVE DNARCYPPPSMRVCAHRLAPVDNINKLLLIDYAARRLVACGSIWQGICQF LRLDDL
    • Amino acids

      23 to 128
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Plexin A3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSSEXGENE
    • Plexin 4
    • Plexin A3
    • PLXN4
    • PLXNA3
    • Semaphorin receptor SEX
    • SEX
    • Transmembrane protein sex
    • XAP 6
    see all
  • Relevance

    Plexin A3 is a coreceptor for the class 3 secreted semaphorins. This family of semaphorins binds to a complex composed of a neuropilin and a plexin. The plexin type modulates the affinity of the complex for specific semaphorins and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm. Plexin A3 is a putative receptor involved in the development of neural and epithelial tissues.
  • Cellular localization

    Membrane; single-pass type I membrane protein.

Images

  • ab163122 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up