Overview

  • Product name

    Recombinant Human PLXNC1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSL VEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFK
    • Amino acids

      250 to 348
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD232
    • Plexin-C1
    • PLXC1_HUMAN
    • Plxnc1
    • Virus-encoded semaphorin protein receptor
    see all
  • Function

    Receptor for SEMA7A, for smallpox semaphorin A39R, vaccinia virus semaphorin A39R and for herpesvirus Sema protein. Binding of semaphorins triggers cellular responses leading to the rearrangement of the cytoskeleton and to secretion of IL6 and IL8.
  • Tissue specificity

    Detected in heart, brain, lung, spleen and placenta.
  • Sequence similarities

    Belongs to the plexin family.
    Contains 1 Sema domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160845 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up