Description

  • Product name

    Recombinant Human PMM1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab101111 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAVTAQAARRKERVLCLFDVDGTLTPARQK IDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIE FRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIF ADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      1 to 262
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.00174% PMSF, 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Brain glucose-1,6-bisphosphatase
    • Phosphomannomutase 1
    • PMM 1
    • pmm1
    • PMM1_HUMAN
    • PMMH 22
    • PMMH-22
    • PMMH22
    • Sec53
    see all
  • Function

    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain.
  • Tissue specificity

    Strong expression in liver, heart, brain, and pancreas; lower expression in skeletal muscle.
  • Pathway

    Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 2/2.
  • Sequence similarities

    Belongs to the eukaryotic PMM family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101111.

References

ab101111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up