Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEK EGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCD VWMIQNGTLIESGIIGRSRKDFKRYLLNFIAAMPLISLVNNFLKYGLNEL KLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQDVEKFCNSV VDLYSNLSKPFLDIVLYIFKLTSAIGAQVLGKILWH
    • Molecular weight

      52 kDa including tags
    • Amino acids

      1 to 236

Specifications

Our Abpromise guarantee covers the use of ab131894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 70 kDa peroxisomal membrane protein
    • ABC 43
    • ABC D3
    • ABC43
    • ABCD 3
    • Abcd3
    • ABCD3 protein
    • ABCD3_HUMAN
    • ATP binding cassette sub family D (ALD) member 3
    • ATP binding cassette sub family D member 3
    • ATP-binding cassette sub-family D member 3
    • CBAS5
    • dJ824O18.1 (ATP-binding cassette, sub family D (ALD), member 3 (PMP70, PXMP1))
    • Peroxisomal membrane protein 1
    • Peroxisomal membrane protein 1 (70kD)
    • Peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
    • PMP 70
    • PMP70
    • PXMP 1
    • PXMP1
    • ZWS2
    see all
  • Function

    Probable transporter. The nucleotide-binding fold acts as an ATP-binding subunit with ATPase activity.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization

    Peroxisome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131894 stained with Coomassie Blue.

References

ab131894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up