Overview

  • Product name
    Recombinant Human PNAD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQ QRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKA EVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQ EDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPE EQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQIL ENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDG LWEKISSPGS
    • Amino acids
      1 to 310
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NTAN1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N terminal Asn amidase
    • N terminal asparagine amidase
    • N terminal asparagine amidohydrolase
    • NTAN1
    • NTN-amidase
    • PNAA
    • PNAD
    • Protein N-terminal Asn amidase
    • Protein N-terminal asparagine amidase
    • Protein N-terminal asparagine amidohydrolase
    • Protein NH2-terminal asparagine amidohydrolase
    • Protein NH2-terminal asparagine deamidase
    • Protein NTN-amidase
    see all
  • Relevance
    PNAD is required for the ubiquitin-dependent turnover of intracellular proteins that initiate with Met-Asn. This enzyme does not act on substrates with internal or C-terminal asparagines and does not act on glutamine residues in any position.
  • Cellular localization
    Cytoplasmic

Images

  • ab165200 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up