Overview

  • Product name

    Recombinant Human PNKD protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGK EEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRA RNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSD PRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDG IPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLF SGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGF AGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK
    • Amino acids

      1 to 385
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Probable hydrolase PNKD.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2210013N15Rik
    • 2810403H05Rik
    • AI854243
    • BRAIN PROTEIN 17
    • BRP17
    • DYT8
    • FKSG19
    • FPD1
    • KIAA1184
    • KIPP1184
    • MNCb-5687
    • MR-1
    • MR1
    • Myofibrillogenesis regulator 1
    • Paroxysmal nonkinesiogenic dyskinesia protein
    • PDC
    • PKND1
    • Pnkd
    • PNKD_HUMAN
    • Probable hydrolase PNKD
    • TAHCCP2
    • Trans-activated by hepatitis C virus core protein 2
    see all
  • Function

    Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.
  • Tissue specificity

    Isoform 1 is only expressed in the brain. Isoform 2 is ubiquitously detected with highest expression in skeletal muscle and detected in myocardial myofibrils. Variant Val-7 and Val-9 are detected in the brain only.
  • Involvement in disease

    Defects in PNKD are the cause of dystonia type 8 (DYT8) [MIM:118800]. DYT8 is a paroxysmal non-kinesigenic dystonia/dyskinesia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT8 is characterized by attacks of involuntary movements brought on by stress, alcohol, fatigue or caffeine. The attacks generally last between a few seconds and four hours or longer. The attacks may begin in one limb and spread throughout the body, including the face.
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
  • Post-translational
    modifications

    Isoform 2 is phosphorylated at Ser-121 upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus; Mitochondrion and Membrane.
  • Information by UniProt

Images

  • ab161844 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up