Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ VELVADPETRTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLH PLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENL EKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIP RKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVL VATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPG RKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSG PLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLG SWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVPCRCFLF TATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILE IPFRLWVEPRLGRLYCQFSEG
    • Molecular weight

      84 kDa including tags
    • Amino acids

      1 to 521

Specifications

Our Abpromise guarantee covers the use of ab131925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.

     This product was previously labelled as PNK

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • 2''(3'')-polynucleotidase
    • 2'(3')-polynucleotidase
    • Bifunctional polynucleotide phosphatase/kinase
    • DEM 1
    • DEM1
    • DNA 5' kinase/3' phosphatase
    • DNA 5''-kinase/3''-phosphatase
    • EIEE10
    • Homo sapiens polynucleotide kinase 3' phosphatase (PNKP)
    • MCSZ
    • PNK 1
    • PNK1
    • Pnkp
    • PNKP DNA kinase
    • PNKP_HUMAN
    • Polynucleotide 3'-phosphatase
    • Polynucleotide 5' hydroxyl kinase
    • Polynucleotide 5''-hydroxyl-kinase
    • Polynucleotide Kinase
    • Polynucleotide kinase 3 prime phosphatase
    • Polynucleotide kinase 3' phosphatase
    • Polynucleotide kinase-3''-phosphatase
    see all
  • Function

    Catalyzes the phosphorylation of DNA at 5'-hydroxyl termini and can dephosphorylate its 3'-phosphate termini. Plays an important function in DNA repair following ionizing radiation or oxidative damage.
  • Tissue specificity

    Expressed in many tissues with highest expression in spleen and testis, and lowest expression in small intestine (PubMed:10446192). Expressed in higher amount in pancreas, heart and kidney and at lower levels in brain, lung and liver (PubMed:10446193).
  • Involvement in disease

    Defects in PNKP are the cause of microcephaly seizures and development delay (MCSZ) [MIM:613402]. It is characterized by microcephaly, infantile-onset seizures, severe intellectual disability and delayed motor milestones with absent speech or only achieving a few words. Most patients also have behavioral problems with hyperactivity. Microcephaly is progressive and without neuronal migration or structural abnormalities, consistent with primary microcephaly.
  • Sequence similarities

    In the N-terminal section; belongs to the DNA 3' phosphatase family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131925.

References

ab131925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up