Description

  • Product name

    Recombinant Human pNO40 protein
  • Purity

    > 90 % SDS-PAGE.
    ab104634 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVT DYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK NDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEA VLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPD PTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAK KKKKKKKHKKKHKE
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 241
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as ZCCHC17. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.00174% PMSF, 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 2810055E05Rik
    • HSPC251
    • LDC4
    • NO40_HUMAN
    • Nucleolar protein 40
    • Nucleolar protein of 40 kDa
    • OTTHUMP00000003890
    • OTTHUMP00000003891
    • Pnn-interacting nucleolar protein
    • pNO40
    • pS1D
    • PS1D protein
    • Putative S1 RNA binding domain protein
    • Putative S1 RNA-binding domain protein
    • RGD1565267
    • ZCCHC17
    • Zinc finger CCHC domain-containing protein 17
    • Zinc finger, CCHC domain containing 17
    see all
  • Sequence similarities

    Contains 1 CCHC-type zinc finger.
    Contains 1 S1 motif domain.
  • Cellular localization

    Nucleus, nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104634 (3 µg).
    Note: Molecular weight on SDS-PAGE will appear higher than the predicted molecular weight of approximately 30 kDa.

References

ab104634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up