Overview

  • Product name
    Recombinant Human PNPLA8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGF HTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNIC MSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNI KQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKF GDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPD PGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQA LVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQR EKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVA VKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVKGRGIRILSIDGG GTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLD ECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALM IETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYK MWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDV PLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGL LPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAK ILSQEKTTLQKINDWIKLKTDMYEGLPFFSKL
    • Amino acids
      1 to 782
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium-independent phospholipase A2-gamma
    • Intracellular membrane associated calcium independent phospholipase A2 gamma
    • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
    • IPLA2 2
    • iPLA2 gamma
    • IPLA2(GAMMA)
    • iPLA2-2
    • iPLA2-gamma
    • IPLA22
    • IPLA2G
    • Patatin like phospholipase domain containing protein 8
    • Patatin-like phospholipase domain-containing protein 8
    • PLPL8_HUMAN
    • PNPLA-gamma
    • PNPLA8
    see all
  • Function
    Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids.
  • Tissue specificity
    Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart.
  • Sequence similarities
    Contains 1 patatin domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab162349 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up