Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Recombinant Human Podoplanin / gp36 protein (ab132033)

Submit a review Submit a question
SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: WB, SDS-PAGE, ELISA

    Description

    • Product name

      Recombinant Human Podoplanin / gp36 protein
      See all Podoplanin / gp36 proteins and peptides

    • Expression system

      Wheat germ

    • Accession

      Q86YL7-3

    • Protein length

      Full length protein

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        MLTPLGKFSTAKFAVRLPRVWEARAPSLSGAPAPTPPAPPPSRSSRLGLW PRCFLIFPQLRILLLGPQESNNSTGTMWKVSALLFVLGSASLWVLAEGAS TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNS VTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKD GLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP

      • Predicted molecular weight

        51 kDa including tags

      • Amino acids

        1 to 238

      • Tags

        GST tag N-Terminus

    Specifications

    Our Abpromise guarantee covers the use of ab132033 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      SDS-PAGE

      ELISA

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • Aggrus
      • Glycoprotein 36 KD
      • Glycoprotein 36
      • gp 36
      • GP 38
      • GP 40
      • gp36
      • GP38
      • GP40
      • HT1A 1
      • HT1A1
      • hT1alpha 1
      • hT1alpha 2
      • hT1alpha1
      • hT1alpha2
      • Lung type I cell membrane associated glycoprotein
      • Lung type I cell membrane associated glycoprotein isoform a
      • Lung type I cell membrane associated glycoprotein T1A 2
      • OTS 8
      • OTS8
      • OTTHUMP00000009640
      • OTTHUMP00000044504
      • PA2.26
      • PA2.26 antigen
      • Pdpn
      • PDPN_HUMAN
      • Podoplanin
      • PSEC0003
      • PSEC0025
      • T1 alpha
      • T1 ALPHA GENE
      • T1-alpha
      • T1A
      • T1A 2
      • TI1A
      • TIA 2
      • TIA2
      see all

    • Function

      May be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Required for normal lung cell proliferation and alveolus formation at birth. Induces platelet aggregation. Does not have any effect on folic acid or amino acid transport. Does not function as a water channel or as a regulator of aquaporin-type water channels.

    • Tissue specificity

      Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors and expressed in 25% of early oral squamous cell carcinomas.

    • Sequence similarities

      Belongs to the podoplanin family.

    • Post-translational
      modifications

      Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity.
      The N-terminus is blocked.

    • Cellular localization

      Membrane. Cell projection > filopodium membrane. Cell projection > lamellipodium membrane. Cell projection > microvillus membrane. Cell projection > ruffle membrane. Localized to actin-rich microvilli and plasma membrane projections such as filopodia, lamellipodia and ruffles.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)
      SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)
      12.5% SDS-PAGE stained with Coomassie Blue showing ab132033 at approximately 51.3 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab132033? Please let us know so that we can cite the reference in this datasheet.

    ab132033 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab132033.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com