For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-podoplanin--gp36-protein-ab132033.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Other
Share by email

Recombinant Human Podoplanin / gp36 protein (ab132033)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: WB, SDS-PAGE, ELISA

    You may also be interested in

    Primary
    Product image
    FITC Anti-Podoplanin / gp36 antibody [18H5] (ab205333)
    Primary
    Product image
    Anti-Podoplanin / gp36 antibody [EPR7072] - BSA and Azide free (ab235141)
    Primary
    Product image
    Anti-Podoplanin / gp36 antibody [PMab-1] - BSA and Azide free (ab256564)

    View more associated products

    Description

    • Product name

      Recombinant Human Podoplanin / gp36 protein
      See all Podoplanin / gp36 proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      Q86YL7-3
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MLTPLGKFSTAKFAVRLPRVWEARAPSLSGAPAPTPPAPPPSRSSRLGLW PRCFLIFPQLRILLLGPQESNNSTGTMWKVSALLFVLGSASLWVLAEGAS TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNS VTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKD GLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP
      • Predicted molecular weight

        51 kDa including tags
      • Amino acids

        1 to 238
      • Tags

        GST tag N-Terminus

    Associated products

    • Related Products

      • Anti-Podoplanin / gp36 antibody (ab10274)
      • Anti-Podoplanin / gp36 antibody [18H5] - BSA and Azide free (ab10288)
      • Anti-Podoplanin / gp36 antibody [EPR7072] (ab128994)
      • Anti-Podoplanin / gp36 antibody [EPR7073] (ab131216)

    Specifications

    Our Abpromise guarantee covers the use of ab132033 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      SDS-PAGE

      ELISA

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • Aggrus
      • Glycoprotein 36 KD
      • Glycoprotein 36
      • gp 36
      • GP 38
      • GP 40
      • gp36
      • GP38
      • GP40
      • HT1A 1
      • HT1A1
      • hT1alpha 1
      • hT1alpha 2
      • hT1alpha1
      • hT1alpha2
      • Lung type I cell membrane associated glycoprotein
      • Lung type I cell membrane associated glycoprotein isoform a
      • Lung type I cell membrane associated glycoprotein T1A 2
      • OTS 8
      • OTS8
      • OTTHUMP00000009640
      • OTTHUMP00000044504
      • PA2.26
      • PA2.26 antigen
      • Pdpn
      • PDPN_HUMAN
      • Podoplanin
      • PSEC0003
      • PSEC0025
      • T1 alpha
      • T1 ALPHA GENE
      • T1-alpha
      • T1A
      • T1A 2
      • TI1A
      • TIA 2
      • TIA2
      see all
    • Function

      May be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Required for normal lung cell proliferation and alveolus formation at birth. Induces platelet aggregation. Does not have any effect on folic acid or amino acid transport. Does not function as a water channel or as a regulator of aquaporin-type water channels.
    • Tissue specificity

      Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors and expressed in 25% of early oral squamous cell carcinomas.
    • Sequence similarities

      Belongs to the podoplanin family.
    • Post-translational
      modifications

      Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity.
      The N-terminus is blocked.
    • Cellular localization

      Membrane. Cell projection > filopodium membrane. Cell projection > lamellipodium membrane. Cell projection > microvillus membrane. Cell projection > ruffle membrane. Localized to actin-rich microvilli and plasma membrane projections such as filopodia, lamellipodia and ruffles.
    • Target information above from: UniProt accession Q86YL7 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)
      SDS-PAGE - Recombinant Human Podoplanin / gp36 protein (ab132033)
      12.5% SDS-PAGE stained with Coomassie Blue showing ab132033 at approximately 51.3 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (0)

    Publishing research using ab132033? Please let us know so that we can cite the reference in this datasheet.

    ab132033 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab132033.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.