Overview

  • Product name

    Recombinant Human POFUT2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDV NPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQV RIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEG TWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSAS IVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVG DEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIW GHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMV RFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREIL GLDPKTTYNRFCGDQEKACEQPTHWKITY
    • Molecular weight

      76 kDa including tags
    • Amino acids

      1 to 429

Specifications

Our Abpromise guarantee covers the use of ab132710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C21orf80
    • EC 2.4.1.221
    • FUT 13
    • FUT13
    • GDP fucose protein O fucosyltransferase 2
    • GDP-fucose protein O-fucosyltransferase 2
    • KIAA0958
    • O FucT 2
    • O-FucT-2
    • OFucT2
    • OFUT2_HUMAN
    • Peptide O fucosyltransferase 2
    • Peptide-O-fucosyltransferase 2
    • POFUT 2
    • POFUT2
    • Protein O fucosyltransferase 2
    see all
  • Function

    Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats.
  • Tissue specificity

    Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liver, lung, stomach, testis, placenta, skin, thymus, pancreas, mammary gland, prostate, fetal brain, fetal liver and fetal heart.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 68 family.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab132710 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up