Description

  • Product name

    Recombinant Human POLD2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQY AHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKA MPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDV SKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVS GLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSH STQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPI SFSGFGAEDDDLGGLGLGP
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1 to 469

Specifications

Our Abpromise guarantee covers the use of ab114798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as DNA polymerase delta p50

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DNA polymerase delta subunit 2
    • DNA polymerase delta subunit p50
    • DNA polymerase subunit delta 2
    • DNA polymerase subunit delta p50
    • DPOD2_HUMAN
    • POLD 2
    • pold2
    see all
  • Function

    The function of the small subunit is not yet clear.
  • Sequence similarities

    Belongs to the DNA polymerase delta/II small subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab114798 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up