Recombinant human Poliovirus Receptor protein (ab155723)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant human Poliovirus Receptor protein
See all Poliovirus Receptor proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQ TQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDE GNYTCLFVTFPQGSRSVDIWLR VLAKPQNTAEVQKVQLTGEPVPMARC VSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTV TVTSLWILVPSSQV DGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQN EA TLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLIC NVTNALGA RQAELTVQVKEGPPSEHSGISRN
-
Molecular weight28 kDa including tags
-
Amino acids21 to 343
-
TagsHis tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155723 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Biological activityMeasure by its ability to bind with recombinant Human DNAM1 / CD226 in a functional ELISA assay
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 1.000 Eu/µg
-
Purity>95% by SDS-PAGE .
ab155723 was lyophilized from 0.22 µm filtered solution. -
FormLyophilised
-
Additional notesMeasure by its ability to bind with recombinant Human DNAM1 / CD226 in a functional ELISA assay
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- CD155
- CD155 antigen
- FLJ25946
see all -
FunctionMediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.
-
Sequence similaritiesBelongs to the nectin family.
Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localizationSecreted and Cell membrane.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human Poliovirus Receptor protein (ab155723)SDS-PAGE analysis of reduced ab155723 stained overnight with Coomassie Blue
Datasheets and documents
References
ab155723 has not yet been referenced specifically in any publications.
