Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQ TQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDE GNYTCLFVTFPQGSRSVDIWLR VLAKPQNTAEVQKVQLTGEPVPMARC VSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTV TVTSLWILVPSSQV DGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQN EA TLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLIC NVTNALGA RQAELTVQVKEGPPSEHSGISRN
    • Molecular weight
      28 kDa including tags
    • Amino acids
      21 to 343
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measure by its ability to bind with recombinant Human DNAM1 / CD226 in a functional ELISA assay
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab155723 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measure by its ability to bind with recombinant Human DNAM1 / CD226 in a functional ELISA assay
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD155
    • CD155 antigen
    • FLJ25946
    • HVED
    • mE4
    • NECL 5
    • Necl-5
    • Necl5
    • Nectin like 5
    • Nectin like protein 5
    • Nectin-like protein 5
    • Ortholog of mouse Tage4
    • Poliovirus receptor
    • PVR
    • PVR_HUMAN
    • PVS
    • Taa1
    • Tage 4
    • TAGE4
    see all
  • Function
    Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.
  • Sequence similarities
    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155723 stained overnight with Coomassie Blue

References

ab155723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up