Bioactive grade

Recombinant human Poliovirus Receptor/PVR protein (Fc Chimera Active) (ab220561)

Description

  • Product name

    Recombinant human Poliovirus Receptor/PVR protein (Fc Chimera Active)
    See all Poliovirus Receptor/PVR proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human ab220561 at 10 μg/mL (100 μL/well) can bind Biotinylated Human TIGIT, His Tag with a linear range of 0.08-0.31 μg/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN YTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTG GRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVT CKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARS NPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGA RQAELTVQVKEGPPSEHSGISRN
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      21 to 343
    • Additional sequence information

      This protein carries a human IgG1 Fc tag(Pro 100 - Lys 330) P01857 at the C-terminus. Extracellular domain (AAH15542).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220561 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Poliovirus Receptor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD155
    • CD155 antigen
    • FLJ25946
    • HVED
    • mE4
    • NECL 5
    • Necl-5
    • Necl5
    • Nectin like 5
    • Nectin like protein 5
    • Nectin-like protein 5
    • Ortholog of mouse Tage4
    • Poliovirus receptor
    • PVR
    • PVR_HUMAN
    • PVS
    • Taa1
    • Tage 4
    • TAGE4
    see all
  • Function

    Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.
  • Sequence similarities

    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • FACS analysis shows that the binding of Human CD155, Fc Tag to 293T overexpressing TIGIT was inhibited by increasing concentration of neutralizing Anti-Human TIGIT MAb. The concentration of CD155 used is 1 µg/ml. The IC50 is 0.09422 µg/ml.
  • FACS assay shows that recombinant Human CD155, Fc Tag can bind to 293T cell overexpressing human TIGIT. The concentration of CD155 is 1 µg/ml.
  • Immobilized Human CD155, Fc Tag at 5 µg/mL (100 µL/well) can bind Biotinylated Human TIGIT, His Tag with a linear range of 5-78 ng/mL.
  • SDS-PAGE analysis of reduced ab220561 stained overnight with Coomassie Blue.

    The protein migrates as 95-105 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.

References

ab220561 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220561.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up