Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFR VDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSI VQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNP HAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA QLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAA EELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 346

Specifications

Our Abpromise guarantee covers the use of ab132610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 40kDa
    • AA409007
    • AA959927
    • Ac2-127
    • AC40
    • AL024089
    • DNA directed RNA polymerase I subunit C
    • DNA directed RNA polymerases I and III 40 kDa polypeptide
    • DNA directed RNA polymerases I and III subunit RPAC1
    • DNA-directed RNA polymerase I subunit C
    • DNA-directed RNA polymerases I and III 40 kDa polypeptide
    • DNA-directed RNA polymerases I and III subunit RPAC1
    • MGC105583
    • MGC161175
    • POLR1C
    • POLR1E
    • Polymerase (RNA) I polypeptide C, 30kDa
    • RNA polymerase 1 1
    • RNA polymerase I subunit C
    • RNA polymerases I and III subunit AC1
    • RP3-337H4.4
    • RPA39
    • RPA40
    • RPA5
    • RPAC1
    • RPAC1_HUMAN
    • RPC40
    • Rpo1 1
    • TCS3
    see all
  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
  • Involvement in disease

    Treacher Collins syndrome 3 (TCS3) [MIM:248390]: A form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132610 stained with Coomassie Blue.

References

ab132610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up