Overview

  • Product name
    Recombinant Human POLR3B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFI NVEIKKIMKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPH
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C128
    • DNA directed RNA polymerase III 127.6 kDa polypeptide
    • DNA directed RNA polymerase III subunit B
    • DNA-directed RNA polymerase III 127.6 kDa polypeptide
    • DNA-directed RNA polymerase III subunit B
    • DNA-directed RNA polymerase III subunit RPC2
    • FLJ10388
    • polr3b
    • Polymerase (RNA) III (DNA directed) polypeptide B
    • RNA polymerase III subunit C2
    • RNA polymerase III subunit RPC2
    • RPC2
    • RPC2_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity). Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similarities
    Belongs to the RNA polymerase beta chain family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163185 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up