Recombinant Human POLR3K protein (ab162651)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVD DVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNA QCGHRWRD
    • Amino acids
      1 to 108
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C11
    • C11 RNP3
    • DNA directed RNA polymerase III subunit K
    • DNA directed RNA polymerase III subunit RPC10
    • DNA directed RNA polymerases III 12.5 kDa polypeptide
    • DNA-directed RNA polymerase III subunit K
    • DNA-directed RNA polymerase III subunit RPC10
    • hRPC11
    • HsC11p
    • My010
    • POLR3K
    • Polymerase (RNA) III (DNA directed) polypeptide K
    • Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
    • RNA polymerase III 12.5 kDa subunit
    • RNA polymerase III subunit (hRPC11)
    • RNA polymerase III subunit C10
    • RNA polymerase III subunit C11
    • RNA polymerase III subunit CII
    • RPC10
    • RPC10_HUMAN
    • RPC11
    • RPC12.5
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similarities
    Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up