Description

  • Product name

    Recombinant Human POLR3K protein (BSA and azide free)
  • Purity

    > 85 % SDS-PAGE.
    ab180315 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMLLFCPGCGNGLIVEEGQRCHRFACNT CPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRA YFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1 to 108
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab180315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 50% Glycerol, 0.03% DTT, 0.06% EDTA

General Info

  • Alternative names

    • C11
    • C11 RNP3
    • DNA directed RNA polymerase III subunit K
    • DNA directed RNA polymerase III subunit RPC10
    • DNA directed RNA polymerases III 12.5 kDa polypeptide
    • DNA-directed RNA polymerase III subunit K
    • DNA-directed RNA polymerase III subunit RPC10
    • hRPC11
    • HsC11p
    • My010
    • POLR3K
    • Polymerase (RNA) III (DNA directed) polypeptide K
    • Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
    • RNA polymerase III 12.5 kDa subunit
    • RNA polymerase III subunit (hRPC11)
    • RNA polymerase III subunit C10
    • RNA polymerase III subunit C11
    • RNA polymerase III subunit CII
    • RPC10
    • RPC10_HUMAN
    • RPC11
    • RPC12.5
    see all
  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Sequence similarities

    Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180315 (3 µg).

References

ab180315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up