Bioactive grade

Recombinant human Polymeric immunoglobulin receptor/PIGR protein (Active) (ab174011)

Description

  • Product name

    Recombinant human Polymeric immunoglobulin receptor/PIGR protein (Active)
    See all Polymeric immunoglobulin receptor/PIGR proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.
    Immobilized ab174011 at 2 μg/ml, the concentration of Human IgM that produces 50% of the optimal binding response is appoximately 20-200 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    ab174011 was lyophilized from 0.22 µm filtered solution.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLI SSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRG LSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQ IGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQY LCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAK FLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKE DAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVA VLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEE PGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPG NVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFV NCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAA GSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQA DGSRASVDSGSSEEQGGSSR
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      19 to 638
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    ELISA

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as PIGR. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is approximately about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    t is recommended to reconstitute the lyophilized protein in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • Hepatocellular carcinoma associated protein TB6
    • Hepatocellular carcinoma-associated protein TB6
    • MGC125361
    • MGC125362
    • Phosphatidylinositol glycan, class R
    • PIGR
    • PIGR_HUMAN
    • Poly Ig receptor
    • Poly-Ig receptor
    • Polymeric immunoglobulin receptor
    • Secretory component
    • Transmembrane secretory component
    see all
  • Function

    This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylation is not necessary for Ig binding.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Human pIgR (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
  • The purity of ab174011 was determined by reduced SDS-PAGE and staining overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 85-95 kDa due to glycosylation.

References

ab174011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up