Recombinant Human Polymeric immunoglobulin receptor/PIGR protein (Fc Chimera) (ab196106)

Description

  • Product name

    Recombinant Human Polymeric immunoglobulin receptor/PIGR protein (Fc Chimera)
    See all Polymeric immunoglobulin receptor/PIGR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity of ab196106 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLI SSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRG LSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQ IGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQY LCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAK FLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKE DAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVA VLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEE PGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPG NVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFV NCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAA GSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQA DGSRASVDSGSSEEQGGSSRVDDIEGRMDEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK
    • Predicted molecular weight

      95 kDa including tags
    • Amino acids

      19 to 638
    • Additional sequence information

      Fused with a FC tag at the C terminus.

Specifications

Our Abpromise guarantee covers the use of ab196106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as PIGR. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µm filtered solution

General Info

  • Alternative names

    • Hepatocellular carcinoma associated protein TB6
    • Hepatocellular carcinoma-associated protein TB6
    • MGC125361
    • MGC125362
    • Phosphatidylinositol glycan, class R
    • PIGR
    • PIGR_HUMAN
    • Poly Ig receptor
    • Poly-Ig receptor
    • Polymeric immunoglobulin receptor
    • Secretory component
    • Transmembrane secretory component
    see all
  • Function

    This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylation is not necessary for Ig binding.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab196106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up