Description

  • Product name

    Recombinant Human POPDC2/POP2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGC FYLFGFLSAGYLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLR EDTLPEEFDLLYKTLCLPLQVPLQTYKEIVHCCEEQVLTLATEQTYAVEG ETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLQPSEEGVFQ VTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLND KLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVIS RGQAPLAPTHTPEL
    • Amino acids

      1 to 364
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as POPDC2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • POP 2
    • POP2
    • POPD2_HUMAN
    • POPDC 2
    • Popdc2
    • Popeye domain containing 2
    • Popeye domain containing protein 2
    • Popeye domain-containing protein 2
    • Popeye protein 2
    see all
  • Function

    Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density.
  • Tissue specificity

    Expressed predominantly in the heart and in the skeletal muscle.
  • Sequence similarities

    Belongs to the popeye family.
  • Cellular localization

    Membrane. Cell membrane, sarcolemma.
  • Information by UniProt

Images

  • ab163772 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up