Overview

  • Product name

    Recombinant Human POPDC3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGL LYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVR SITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKT SIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVT LTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRV YIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK
    • Amino acids

      1 to 291

Specifications

Our Abpromise guarantee covers the use of ab216264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    ab216264 is a GST-tag removed version of ab163800.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA355M14.1
    • POP3
    • POPD3
    • POPD3_HUMAN
    • POPDC3
    • Popeye domain containing 3
    • Popeye domain containing protein 3
    • Popeye domain-containing protein 3
    • Popeye protein 3
    • RP11-99L11.2
    see all
  • Function

    May play an important role in heart development.
  • Tissue specificity

    Expressed predominantly in skeletal muscle and detected in heart.
  • Sequence similarities

    Belongs to the popeye family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab216264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up