Overview

  • Product name
    Recombinant Human POU2F3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDL SDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLV PGHLQSVSQ
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • class 2
    • Epoc 1
    • Epoc1
    • HGNC19864
    • Oct 11
    • Oct-11
    • OCT11
    • Octamer binding transcription factor 11
    • Octamer-binding protein 11
    • Octamer-binding transcription factor 11
    • OTF-11
    • PLA 1
    • PLA1
    • PLA1 protein
    • PO2F3_HUMAN
    • POU class 2 homeobox 3
    • POU domain
    • POU domain transcription factor OCT11a
    • POU domain, class 2, transcription factor 3
    • POU transcription factor
    • POU2F3
    • Skn 1a
    • transcription factor 3
    • Transcription factor PLA-1
    • Transcription factor Skn-1
    • Transcription factor Skn1
    see all
  • Function
    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen.
  • Tissue specificity
    Specifically expressed in epidermis and cultured keratinocytes.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up