Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHL GAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
    • Molecular weight

      36 kDa including tags
    • Amino acids

      100 to 190

Specifications

Our Abpromise guarantee covers the use of ab152629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brain specific homeobox/POU domain protein 3C
    • Brain-3C
    • Brain-specific homeobox/POU domain protein 3C
    • BRN 3C
    • Brn-3C
    • BRN3C
    • class 4
    • DFNA 15
    • DFNA15
    • MGC138412
    • PO4F3_HUMAN
    • POU class 4 homeobox 3
    • POU domain
    • POU domain class 4 transcription factor 3
    • POU4F3
    • transcription factor 3
    see all
  • Function

    May play a role in determining or maintaining the identities of a small subset of visual system neurons.
  • Tissue specificity

    Brain. Seems to be specific to the retina.
  • Involvement in disease

    Defects in POU4F3 are the cause of deafness autosomal dominant type 15 (DFNA15) [MIM:602459]. DFNA15 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-4 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152629 stained with Coomassie Blue.

References

ab152629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up