Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLN AQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVI ASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREF AKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQK LKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALN AYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI P
    • Amino acids

      1 to 301
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as POU6F1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brain 5
    • Brain specific homeobox/POU domain protein 5
    • Brn 5
    • Brn 5 protein
    • BRN5
    • Emb
    • MPOU
    • mPOU homeobox protein
    • POU class 6 homeobox 1
    • POU domain class 6 transcription factor 1
    • TCFB1
    see all
  • Relevance

    The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
  • Cellular localization

    Nuclear

Images

  • ab159160 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up