Description

  • Product name

    Recombinant Human PP11 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFAL YSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
    • Amino acids

      270 to 369
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 22 serine protease
    • 26 serine protease
    • Endonuclease, polyU-specific
    • endou
    • ENDOU_HUMAN
    • P11
    • Placental protein 11
    • Poly(U)-specific endoribonuclease
    • PP11
    • Pp11r
    • Protein endoU
    • PRSS26
    • Uridylate-specific endoribonuclease
    see all
  • Function

    Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini.
  • Tissue specificity

    Placental-specific, but also associated with various malignant neoplasms.
  • Sequence similarities

    Belongs to the ENDOU family.
    Contains 2 SMB (somatomedin-B) domains.
  • Post-translational
    modifications

    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab160260 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up