Overview

  • Product name
    Recombinant Human PP7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEY ADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDS IDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVL KQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNG DFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEIL HKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRV ERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTE HEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLI RSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQ YQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKS GKLSVSQWAFCMENILGLNLPWRSLSSNLVNIDQNGNVEYMSSFQNIRIE KPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSS HYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVT NLG
    • Amino acids
      1 to 653
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PPEF1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PP 7
    • PP7
    • PPE1_HUMAN
    • PPEF
    • PPEF 1
    • PPEF-1
    • Ppef1
    • PPP 7C
    • PPP7C
    • PPP7CA
    • Protein phosphatase 7, catalytic subunit, alpha isozyme
    • Protein phosphatase EF hand calcium binding domain 1
    • Protein phosphatase serine/threonine type with EF hands
    • Protein phosphatase with EF calcium binding domain
    • Protein phosphatase with EF calcium-binding domain
    • Protein phosphatase with EF hand calcium binding domain 1
    • Serine/threonine protein phosphatase 7
    • Serine/threonine protein phosphatase with EF hands 1
    • Serine/threonine-protein phosphatase 7
    • Serine/threonine-protein phosphatase with EF-hands 1
    see all
  • Function
    May have a role in the recovery or adaptation response of photoreceptors. May have a role in development.
  • Tissue specificity
    Detected in retina and retinal derived Y-79 retinoblastoma cells. Also found in fetal brain.
  • Sequence similarities
    Belongs to the PPP phosphatase family.
    Contains 3 EF-hand domains.
    Contains 1 IQ domain.
  • Information by UniProt

Images

  • ab159165 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up